PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim10g018000.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family HD-ZIP
Protein Properties Length: 700aa    MW: 79650.1 Da    PI: 6.3646
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim10g018000.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox47.72.6e-152777656
                        S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox  6 tftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                        +++ e +++Le+++e +r p++++r +LA ++gL+ +qVk WFqN+R++ k
  Sopim10g018000.0.1 27 RHSVEATQRLEAFYEICRFPDEDQRNQLAFEVGLDPDQVKGWFQNKRTQSK 77
                        5678999*****************************************998 PP

2START103.73.2e-332364536205
                         HHHHHHHHHHHC-TT-EEEE.....EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEE CS
               START   6 aaqelvkkalaeepgWvkss.....esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla....kaet 81 
                         a +el+ ++ +++p+W kss     +++ +  + ++f+ s+        ++e +r +gvv+m+  +l + + +   +W ++++    ka++
  Sopim10g018000.0.1 236 AINELLGLVHVDKPLWIKSSvdegwTIHRE-GYDTTFPNSNRpyksstARIESSRYFGVVPMTGIDLINNFRNPI-KWMNMFPtivtKAKI 324
                         678999999***********8887633333.333444444435888889************************99.*************** PP

                         EEEECTT...EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--..-TTSEE-EESSEEEEEEEECTCEEEEEEE CS
               START  82 levissg...galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.sssvvRaellpSgiliepksnghskvtwv 167
                         ++v++sg     +qlm+ ++  lsplv  R+fvf+R+++ql+  +w+ vdvS d  ++ +   +s++   ++pSg+li++ ++g+s v w+
  Sopim10g018000.0.1 325 VDVLDSGnteVSIQLMYEKMHILSPLVEaREFVFIRCCKQLQPTTWIMVDVSYDLFKEIQIcAPSYAW--KFPSGCLIQEIGDGRSVVAWI 413
                         ********999****************99***************************999999999987..********************* PP

                         E-EE--SSXX..HHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
               START 168 ehvdlkgrlp..hwllrslvksglaegaktwvatlqrqce 205
                         ehv  +++      l+r+l+ ++++ ga +w atl+r  e
  Sopim10g018000.0.1 414 EHVQIDEKCHevNHLFRHLLCRRHIYGAERWIATLERTSE 453
                         ***9999876569**********************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.2E-15677IPR009057Homeodomain-like
SuperFamilySSF466891.67E-141379IPR009057Homeodomain-like
PROSITE profilePS5007114.1881979IPR001356Homeobox domain
SMARTSM003891.1E-142183IPR001356Homeobox domain
CDDcd000866.97E-122279No hitNo description
PfamPF000467.4E-132777IPR001356Homeobox domain
PROSITE profilePS5084834.282222457IPR002913START domain
SuperFamilySSF559613.02E-21225456No hitNo description
CDDcd088753.50E-71226453No hitNo description
SMARTSM002346.0E-17231454IPR002913START domain
PfamPF018524.2E-27236453IPR002913START domain
Gene3DG3DSA:3.30.530.201.4E-6258423IPR023393START-like domain
SuperFamilySSF559618.24E-8467584No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 700 aa     Download sequence    Send to blast
MADSGEKHVG ESSTRRNASK RKGQGQRHSV EATQRLEAFY EICRFPDEDQ RNQLAFEVGL  60
DPDQVKGWFQ NKRTQSKTKD ERSDNKTLRN ENETLRLEII AMKEAIKNNM GSQSDGPSIG  120
EEERARNVEK MKINIQKLRE ERKRISNIIS SYDGKSFVMD SNSTLESLAD KSLLKQTICG  180
SSIEHTSSGN NNDIYNARIR MNNIPIISKL EQENYGFHHD DSNGEKSIIF EIVVPAINEL  240
LGLVHVDKPL WIKSSVDEGW TIHREGYDTT FPNSNRPYKS STARIESSRY FGVVPMTGID  300
LINNFRNPIK WMNMFPTIVT KAKIVDVLDS GNTEVSIQLM YEKMHILSPL VEAREFVFIR  360
CCKQLQPTTW IMVDVSYDLF KEIQICAPSY AWKFPSGCLI QEIGDGRSVV AWIEHVQIDE  420
KCHEVNHLFR HLLCRRHIYG AERWIATLER TSERYNNEMS TTGFKGEGLK NAMNISQRMV  480
KRFCEILSMT DKLDFSTSLL LNNEDRVSIR KNKETTQSKG FIVTAATSLW VPLSFETIFD  540
LLNDINTRYQ WDAFSGGNYT AEMDRLSTGT STKNCITFIE LNTTRENNMV LLQESGIDKM  600
GAFLIYGLID STAYKSFLSG GNAEEVFILP SGIIISPDGR LTDNNENVKN GSILTVAFQK  660
LNFANNSISQ DQHEEEMAYI HNLLSYTVLK IKALLGCSD*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2445500.0AC244550.5 Solanum lycopersicum strain Heinz 1706 chromosome 10 clone hba-39i10 map 10, complete sequence.
GenBankHG9755220.0HG975522.1 Solanum lycopersicum chromosome ch10, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015089749.10.0PREDICTED: homeobox-leucine zipper protein HDG8-like
TrEMBLK4CYS40.0K4CYS4_SOLLC; Uncharacterized protein
STRINGSolyc10g018000.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10211732
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03260.11e-144homeodomain GLABROUS 8